BDKRB2 Antikörper (N-Term)
-
- Target Alle BDKRB2 Antikörper anzeigen
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BDKRB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2
- Aufreinigung
- Purified
- Immunogen
- Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
- Top Product
- Discover our top product BDKRB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Bradykinin Receptor B2 Blocking Peptide, catalog no. 33R-6004, is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDKRB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Andere Bezeichnung
- Bradykinin Receptor B2 (BDKRB2 Produkte)
- Synonyme
- BDKRB2 antikoerper, b2r antikoerper, bk2 antikoerper, bk-2 antikoerper, bkr2 antikoerper, brb2 antikoerper, kinrec antikoerper, B2R antikoerper, BK-2 antikoerper, BK2 antikoerper, BKR2 antikoerper, BRB2 antikoerper, B2BKR antikoerper, B2BRA antikoerper, B(2) antikoerper, B2 antikoerper, BK2R antikoerper, Bdkrb2 antikoerper, bradykinin receptor B2 antikoerper, bradykinin receptor, beta 2 antikoerper, bradykinin type 2 receptor antikoerper, Bdkrb2 antikoerper, BDKRB2 antikoerper, bdkrb2 antikoerper, kinrec antikoerper, B2R antikoerper
- Hintergrund
- BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-