MGST2 Antikörper (N-Term)
-
- Target Alle MGST2 Antikörper anzeigen
- MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MGST2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MGST2 antibody was raised against the N terminal of MGST2
- Aufreinigung
- Purified
- Immunogen
- MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
- Top Product
- Discover our top product MGST2 Primärantikörper
-
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 117-147), (C-Term) antibody
MGST2 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB17141 unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 27-57) antibodyMGST2 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 1-147) antibodyMGST2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 1-147) antibodyMGST2 Reaktivität: Human ELISA, IP Wirt: Maus Monoclonal 1D11 unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (AA 1-147) antibodyMGST2 Reaktivität: Human ELISA, IP Wirt: Maus Monoclonal 4E1 unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (Internal Region) antibodyMGST2 Reaktivität: Human, Ratte, Maus WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (N-Term) antibodyMGST2 Reaktivität: Human, Ratte, Affe, Rind (Kuh) WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (N-Term) antibodyMGST2 Reaktivität: Human, Ratte, Rind (Kuh), Pferd, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) antibodyMGST2 Reaktivität: Human WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Microsomal Glutathione S-Transferase 2 (MGST2) (Internal Region) antibodyMGST2 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MGST2 Blocking Peptide, catalog no. 33R-5664, is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGST2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))
- Andere Bezeichnung
- MGST2 (MGST2 Produkte)
- Synonyme
- GST2 antikoerper, MGST-II antikoerper, microsomal glutathione S-transferase 2 antikoerper, AM1_4050 antikoerper, MGST2 antikoerper, Mgst2 antikoerper
- Hintergrund
- The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.
- Molekulargewicht
- 16 kDa (MW of target protein)
-
