IL18RAP Antikörper (N-Term)
-
- Target Alle IL18RAP Antikörper anzeigen
- IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL18RAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL18 RAP antibody was raised against the N terminal of IL18 AP
- Aufreinigung
- Purified
- Immunogen
- IL18 RAP antibody was raised using the N terminal of IL18 AP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
- Top Product
- Discover our top product IL18RAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL18RAP Blocking Peptide, catalog no. 33R-6858, is also available for use as a blocking control in assays to test for specificity of this IL18RAP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 AP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))
- Andere Bezeichnung
- IL18RAP (IL18RAP Produkte)
- Synonyme
- IL18RAP antikoerper, ACPL antikoerper, CD218b antikoerper, CDw218b antikoerper, IL18RB antikoerper, interleukin 18 receptor accessory protein antikoerper, IL18RAP antikoerper, Il18rap antikoerper
- Hintergrund
- IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.
- Molekulargewicht
- 66 kDa (MW of target protein)
-