Annexin VII Antikörper (N-Term)
-
- Target Alle Annexin VII (ANXA7) Antikörper anzeigen
- Annexin VII (ANXA7) (Annexin A7 (ANXA7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin VII Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A7 antibody was raised against the N terminal of ANXA7
- Kreuzreaktivität
- Human
- Aufreinigung
- Purified
- Immunogen
- Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
- Top Product
- Discover our top product ANXA7 Primärantikörper
-
anti-Annexin A7 (ANXA7) (AA 1-466) antibody
ANXA7 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (C-Term) antibodyANXA7 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (AA 259-488) antibodyANXA7 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (AA 329-356) antibodyANXA7 Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB22076 unconjugated
anti-Annexin A7 (ANXA7) antibodyANXA7 Reaktivität: Human WB, IHC (p), IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (N-Term) antibodyANXA7 Reaktivität: Human, Maus, Ratte WB, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (AA 445-460), (C-Term) antibodyANXA7 Reaktivität: Human, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) antibodyANXA7 Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (AA 237-466) antibodyANXA7 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Annexin A7 (ANXA7) (N-Term) antibodyANXA7 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Hund, Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A7 Blocking Peptide, catalog no. 33R-6528, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin VII (ANXA7) (Annexin A7 (ANXA7))
- Andere Bezeichnung
- Annexin A7 (ANXA7 Produkte)
- Substanzklasse
- Chemical
- Hintergrund
- ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle.
- Molekulargewicht
- 51 kDa (MW of target protein)
-
