Annexin V Antikörper (N-Term)
-
- Target Alle Annexin V (ANXA5) Antikörper anzeigen
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin V Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A5 antibody was raised against the N terminal of ANXA5
- Kreuzreaktivität
- Human, Maus, Ratte (Rattus), Hund
- Aufreinigung
- Purified
- Immunogen
- Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
- Top Product
- Discover our top product ANXA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A5 Blocking Peptide, catalog no. 33R-8393, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
- Andere Bezeichnung
- Annexin A5 (ANXA5 Produkte)
- Synonyme
- anx antikoerper, anx5 antikoerper, ANX V antikoerper, anxa5 antikoerper, cb989 antikoerper, wu:fa98f06 antikoerper, wu:fj10f10 antikoerper, MGC89158 antikoerper, ANX5 antikoerper, ENX2 antikoerper, PP4 antikoerper, RPRGL3 antikoerper, Anx5 antikoerper, R74653 antikoerper, LC5 antikoerper, enx2 antikoerper, annexin A5 antikoerper, annexin A5b antikoerper, Annexin A5 antikoerper, annexin A5 L homeolog antikoerper, ANXA5 antikoerper, anxa5b antikoerper, anxa5 antikoerper, Anxa5 antikoerper, anxa5.L antikoerper
- Substanzklasse
- Chemical
- Hintergrund
- The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Apoptose
-