IGSF1 Antikörper (N-Term)
-
- Target Alle IGSF1 (INHBP) Antikörper anzeigen
- IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGSF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- IGSF1 antibody was raised against the N terminal of IGSF1
- Aufreinigung
- Purified
- Immunogen
- IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
- Top Product
- Discover our top product INHBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IGSF1 Blocking Peptide, catalog no. 33R-4821, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))
- Andere Bezeichnung
- IGSF1 (INHBP Produkte)
- Hintergrund
- Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.
- Molekulargewicht
- 27 kDa (MW of target protein)
-