FXYD5 Antikörper (N-Term)
-
- Target Alle FXYD5 Antikörper anzeigen
- FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FXYD5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FXYD5 antibody was raised against the N terminal of FXYD5
- Aufreinigung
- Purified
- Immunogen
- FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
- Top Product
- Discover our top product FXYD5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FXYD5 Blocking Peptide, catalog no. 33R-5326, is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))
- Andere Bezeichnung
- FXYD5 (FXYD5 Produkte)
- Hintergrund
- FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.
- Molekulargewicht
- 20 kDa (MW of target protein)
-