FXYD5 Antikörper (N-Term)

Produktnummer ABIN630255

Produktdetails anti-FXYD5 Antikörper

Target: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FXYD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FXYD5 antibody was raised against the N terminal of FXYD5

Aufreinigung: Purified

Immunogen: FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FXYD5 Blocking Peptide, catalog no. 33R-5326, is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FXYD5

Target: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Andere Bezeichnung: FXYD5 (FXYD5 Produkte)

Synonyme: FXYD5 antikoerper, DYSAD antikoerper, IWU1 antikoerper, KCT1 antikoerper, OIT2 antikoerper, PRO6241 antikoerper, RIC antikoerper, EF-8 antikoerper, Oit2 antikoerper, FXYD domain containing ion transport regulator 5 antikoerper, FXYD domain-containing ion transport regulator 5 antikoerper, FXYD5 antikoerper, Fxyd5 antikoerper

Hintergrund: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.

Molekulargewicht: 20 kDa (MW of target protein)