GJB1 Antikörper (C-Term)
-
- Target Alle GJB1 Antikörper anzeigen
- GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GJB1 antibody was raised against the C terminal of GJB1
- Aufreinigung
- Purified
- Immunogen
- GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
- Top Product
- Discover our top product GJB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJB1 Blocking Peptide, catalog no. 33R-3256, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))
- Andere Bezeichnung
- GJB1 (GJB1 Produkte)
- Hintergrund
- This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-