GJB2 Antikörper (N-Term)

Produktnummer ABIN630258

Produktdetails anti-GJB2 Antikörper

Target: GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJB2 antibody was raised against the N terminal of GJB2

Aufreinigung: Purified

Immunogen: GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJB2 Blocking Peptide, catalog no. 33R-8880, is also available for use as a blocking control in assays to test for specificity of this GJB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJB2

Target: GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))

Andere Bezeichnung: GJB2 (GJB2 Produkte)

Hintergrund: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization