CLDN10 Antikörper (C-Term)

Produktnummer ABIN630264

Produktdetails anti-CLDN10 Antikörper

Target: CLDN10 (Claudin 10 (CLDN10))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLDN10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin 10 antibody was raised against the C terminal of CLDN10

Aufreinigung: Purified

Immunogen: Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 10 Blocking Peptide, catalog no. 33R-5765, is also available for use as a blocking control in assays to test for specificity of this Claudin 10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLDN10

Target: CLDN10 (Claudin 10 (CLDN10))

Andere Bezeichnung: Claudin 10 (CLDN10 Produkte)

Synonyme: si:busm1-52i16.3 antikoerper, si:dz52i16.3 antikoerper, CLDN10 antikoerper, DKFZp469F1626 antikoerper, CPETRL3 antikoerper, OSP-L antikoerper, 6720456I16Rik antikoerper, Cldn10a antikoerper, Cldn10b antikoerper, D14Ertd728e antikoerper, claudin 10a antikoerper, claudin 10 antikoerper, cldn10a antikoerper, CLDN10 antikoerper, Cldn10 antikoerper

Hintergrund: CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Hepatitis C