Claudin 9 Antikörper (C-Term)

Produktnummer ABIN630267

Produktdetails anti-Claudin 9 Antikörper

Target: Claudin 9 (CLDN9)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin 9 antibody was raised against the C terminal of CLDN9

Aufreinigung: Purified

Immunogen: Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 9 Blocking Peptide, catalog no. 33R-9930, is also available for use as a blocking control in assays to test for specificity of this Claudin 9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 9

Target: Claudin 9 (CLDN9)

Andere Bezeichnung: Claudin 9 (CLDN9 Produkte)

Synonyme: CLDN9 antikoerper, nmf329 antikoerper, claudin 9 antikoerper, CLDN9 antikoerper, Cldn9 antikoerper

Hintergrund: CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C