CLDN8 Antikörper (C-Term)

Produktnummer ABIN630268

Produktdetails anti-CLDN8 Antikörper

Target: CLDN8 (Claudin 8 (CLDN8))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLDN8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Claudin 8 antibody was raised against the C terminal of CLDN8

Aufreinigung: Purified

Immunogen: Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV

Anwendungsinformationen

Applikationshinweise: WB: 0.5-1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 8 Blocking Peptide, catalog no. 33R-4198, is also available for use as a blocking control in assays to test for specificity of this Claudin 8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLDN8

Target: CLDN8 (Claudin 8 (CLDN8))

Andere Bezeichnung: Claudin 8 (CLDN8 Produkte)

Synonyme: zgc:91900 antikoerper, wu:fa01e05 antikoerper, CLDN8 antikoerper, AI648025 antikoerper, claudin 8 antikoerper, CLDN8 antikoerper, cldn8 antikoerper, Cldn8 antikoerper

Hintergrund: CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Hepatitis C