GJC1 Antikörper (N-Term)
-
- Target Alle GJC1 Antikörper anzeigen
- GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJC1 antibody was raised against the N terminal of GJC1
- Aufreinigung
- Purified
- Immunogen
- GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
- Top Product
- Discover our top product GJC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJC1 Blocking Peptide, catalog no. 33R-3961, is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))
- Andere Bezeichnung
- GJC1 (GJC1 Produkte)
- Hintergrund
- CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-