GJE1 Antikörper (C-Term)

Produktnummer ABIN630271

Produktdetails anti-GJE1 Antikörper

Target: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJE1 antibody was raised against the C terminal of GJE1

Aufreinigung: Purified

Immunogen: GJE1 antibody was raised using the C terminal of GJE1 corresponding to a region with amino acids KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJE1 Blocking Peptide, catalog no. 33R-4739, is also available for use as a blocking control in assays to test for specificity of this GJE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJE1

Target: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Andere Bezeichnung: GJE1 (GJE1 Produkte)

Synonyme: AEY12 antikoerper, Cx23 antikoerper, D230044M03Rik antikoerper, Gjf1 antikoerper, Gsfaey12 antikoerper, CX23 antikoerper, RGD1308189 antikoerper, gap junction protein, epsilon 1 antikoerper, gap junction protein epsilon 1 antikoerper, Gje1 antikoerper, GJE1 antikoerper

Hintergrund: GJE1 is a protein component of GAP junction

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Sensory Perception of Sound