ITGBL1 Antikörper

Produktnummer ABIN630272

Produktdetails anti-ITGBL1 Antikörper

Target: ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGBL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITGBL1 Blocking Peptide, catalog no. 33R-6373, is also available for use as a blocking control in assays to test for specificity of this ITGBL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGBL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGBL1

Target: ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))

Andere Bezeichnung: ITGBL1 (ITGBL1 Produkte)

Synonyme: ITGBL1 antikoerper, B930011D01Rik antikoerper, OSCP antikoerper, TIED antikoerper, integrin subunit beta like 1 antikoerper, integrin, beta-like 1 antikoerper, integrin subunit beta like 1 L homeolog antikoerper, ITGBL1 antikoerper, Itgbl1 antikoerper, itgbl1.L antikoerper

Hintergrund: The function of ITGBL1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 54 kDa (MW of target protein)