NOV Antikörper (C-Term)
-
- Target Alle NOV Antikörper anzeigen
- NOV (Nephroblastoma Overexpressed (NOV))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOV Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NOV antibody was raised against the C terminal of NOV
- Aufreinigung
- Purified
- Immunogen
- NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
- Top Product
- Discover our top product NOV Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOV Blocking Peptide, catalog no. 33R-4680, is also available for use as a blocking control in assays to test for specificity of this NOV antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOV antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOV (Nephroblastoma Overexpressed (NOV))
- Andere Bezeichnung
- NOV (NOV Produkte)
- Hintergrund
- As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Growth Factor Binding
-