SDCBP Antikörper

Produktnummer ABIN630291

Produktdetails anti-SDCBP Antikörper

Target: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDCBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDCBP Blocking Peptide, catalog no. 33R-9561, is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDCBP

Target: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Andere Bezeichnung: SDCBP (SDCBP Produkte)

Synonyme: MDA-9 antikoerper, ST1 antikoerper, SYCL antikoerper, TACIP18 antikoerper, Sycl antikoerper, syntenin-1 antikoerper, mda-9 antikoerper, st1 antikoerper, sycl antikoerper, tacip18 antikoerper, MGC81274 antikoerper, syntenin antikoerper, wu:fc51c03 antikoerper, wu:fk31e01 antikoerper, zgc:55679 antikoerper, zgc:77716 antikoerper, sb:eu862 antikoerper, si:dkey-235k4.1 antikoerper, syndecan binding protein antikoerper, syndecan binding protein L homeolog antikoerper, syndecan binding protein (syntenin) 2 antikoerper, syndecan binding protein (syntenin) antikoerper, SDCBP antikoerper, Sdcbp antikoerper, sdcbp.L antikoerper, LOC732879 antikoerper, sdcbp2 antikoerper, sdcbp antikoerper

Hintergrund: SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Molekulargewicht: 32 kDa (MW of target protein)