SDCBP Antikörper
-
- Target Alle SDCBP Antikörper anzeigen
- SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SDCBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
- Top Product
- Discover our top product SDCBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SDCBP Blocking Peptide, catalog no. 33R-9561, is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))
- Andere Bezeichnung
- SDCBP (SDCBP Produkte)
- Synonyme
- MDA-9 antikoerper, ST1 antikoerper, SYCL antikoerper, TACIP18 antikoerper, Sycl antikoerper, syntenin-1 antikoerper, mda-9 antikoerper, st1 antikoerper, sycl antikoerper, tacip18 antikoerper, MGC81274 antikoerper, syntenin antikoerper, wu:fc51c03 antikoerper, wu:fk31e01 antikoerper, zgc:55679 antikoerper, zgc:77716 antikoerper, sb:eu862 antikoerper, si:dkey-235k4.1 antikoerper, syndecan binding protein antikoerper, syndecan binding protein L homeolog antikoerper, syndecan binding protein (syntenin) 2 antikoerper, syndecan binding protein (syntenin) antikoerper, SDCBP antikoerper, Sdcbp antikoerper, sdcbp.L antikoerper, LOC732879 antikoerper, sdcbp2 antikoerper, sdcbp antikoerper
- Hintergrund
- SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.
- Molekulargewicht
- 32 kDa (MW of target protein)
-