SLC39A6 Antikörper
-
- Target Alle SLC39A6 Antikörper anzeigen
- SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SLC39 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
- Top Product
- Discover our top product SLC39A6 Primärantikörper
-
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (Middle Region) antibody
SLC39A6 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Schaf, Pferd, Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (AA 170-320) antibodySLC39A6 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (AA 251-264), (Extracellular), (N-Term) antibodySLC39A6 Reaktivität: Human, Maus, Ratte WB, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (AA 29-325) antibodySLC39A6 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) antibodySLC39A6 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (Internal Region) antibodySLC39A6 Reaktivität: Human, Maus, Ratte WB, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (AA 26-75) antibodySLC39A6 Reaktivität: Human, Maus, Ratte, Hund, Affe, Kaninchen, Rind (Kuh), Schaf, Pferd, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (AA 170-320) antibodySLC39A6 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (N-Term) antibodySLC39A6 Reaktivität: Human, Affe IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A6 Blocking Peptide, catalog no. 33R-8173, is also available for use as a blocking control in assays to test for specificity of this SLC39A6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))
- Andere Bezeichnung
- SLC39A6 (SLC39A6 Produkte)
- Synonyme
- liv1 antikoerper, wu:fc25a09 antikoerper, ZIP6 antikoerper, Ermelin antikoerper, LIV-1 antikoerper, solute carrier family 39 (zinc transporter), member 6 antikoerper, solute carrier family 39 member 6 antikoerper, solute carrier family 39 (metal ion transporter), member 6 antikoerper, slc39a6 antikoerper, SLC39A6 antikoerper, Slc39a6 antikoerper
- Hintergrund
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-
