SLC35C1 Antikörper (N-Term)

Produktnummer ABIN630296

Produktdetails anti-SLC35C1 Antikörper

Target: SLC35C1 (Solute Carrier Family 35, Member C1 (SLC35C1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35C1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC35 C1 antibody was raised against the N terminal of SLC35 1

Aufreinigung: Purified

Immunogen: SLC35 C1 antibody was raised using the N terminal of SLC35 1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35C1 Blocking Peptide, catalog no. 33R-9287, is also available for use as a blocking control in assays to test for specificity of this SLC35C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35C1

Target: SLC35C1 (Solute Carrier Family 35, Member C1 (SLC35C1))

Andere Bezeichnung: SLC35C1 (SLC35C1 Produkte)

Synonyme: CDG2C antikoerper, FUCT1 antikoerper, E430007K15Rik antikoerper, fuct1 antikoerper, GDP-Fuc-Tr antikoerper, SLC35C1 antikoerper, wu:fc03b12 antikoerper, zgc:101867 antikoerper, solute carrier family 35 member C1 antikoerper, GDP-fucose transporter 1 antikoerper, hypothetical protein antikoerper, solute carrier family 35, member C1 antikoerper, solute carrier family 35 (GDP-fucose transporter), member C1 antikoerper, SLC35C1 antikoerper, Chro.40354 antikoerper, PGTG_17642 antikoerper, Tsp_08269 antikoerper, Slc35c1 antikoerper, slc35c1 antikoerper

Hintergrund: SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen.

Molekulargewicht: 40 kDa (MW of target protein)