TMEM104 Antikörper (Middle Region)

Produktnummer ABIN630297

Produktdetails anti-TMEM104 Antikörper

Target: TMEM104 (Transmembrane Protein 104 (TMEM104))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM104 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM104 antibody was raised against the middle region of TMEM104

Aufreinigung: Purified

Immunogen: TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM104 Blocking Peptide, catalog no. 33R-3200, is also available for use as a blocking control in assays to test for specificity of this TMEM104 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM104 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM104

Target: TMEM104 (Transmembrane Protein 104 (TMEM104))

Andere Bezeichnung: TMEM104 (TMEM104 Produkte)

Synonyme: RGD1307953 antikoerper, C630005D06Rik antikoerper, mFLJ00021 antikoerper, transmembrane protein 104 antikoerper, CpipJ_CPIJ018706 antikoerper, CpipJ_CPIJ018704 antikoerper, TMEM104 antikoerper, Tmem104 antikoerper

Hintergrund: The function of TMEM104 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)