MFAP3L Antikörper (N-Term)

Produktnummer ABIN630299

Produktdetails anti-MFAP3L Antikörper

Target: MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP3L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MFAP3 L antibody was raised against the N terminal of MFAP3

Aufreinigung: Purified

Immunogen: MFAP3 L antibody was raised using the N terminal of MFAP3 corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP3L Blocking Peptide, catalog no. 33R-6090, is also available for use as a blocking control in assays to test for specificity of this MFAP3L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP3L

Target: MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))

Andere Bezeichnung: MFAP3L (MFAP3L Produkte)

Synonyme: NYD-sp9 antikoerper, 4933428A15Rik antikoerper, 5430405D20Rik antikoerper, AI461995 antikoerper, AW125052 antikoerper, mKIAA0626 antikoerper, microfibril associated protein 3 like antikoerper, microfibril associated protein 3 like S homeolog antikoerper, microfibrillar associated protein 3 like antikoerper, microfibrillar-associated protein 3-like antikoerper, MFAP3L antikoerper, mfap3l.S antikoerper, Mfap3l antikoerper

Hintergrund: The function of MFAP3L protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 45 kDa (MW of target protein)