MFAP3L Antikörper (N-Term)
-
- Target Alle MFAP3L Antikörper anzeigen
- MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MFAP3L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MFAP3 L antibody was raised against the N terminal of MFAP3
- Aufreinigung
- Purified
- Immunogen
- MFAP3 L antibody was raised using the N terminal of MFAP3 corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
- Top Product
- Discover our top product MFAP3L Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MFAP3L Blocking Peptide, catalog no. 33R-6090, is also available for use as a blocking control in assays to test for specificity of this MFAP3L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))
- Andere Bezeichnung
- MFAP3L (MFAP3L Produkte)
- Hintergrund
- The function of MFAP3L protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 45 kDa (MW of target protein)
-