ZFYVE27 Antikörper (C-Term)

Produktnummer ABIN630303

Produktdetails anti-ZFYVE27 Antikörper

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZFYVE27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZFYVE27 antibody was raised against the C terminal of ZFYVE27

Aufreinigung: Purified

Immunogen: ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZFYVE27 Blocking Peptide, catalog no. 33R-9076, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZFYVE27

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Andere Bezeichnung: ZFYVE27 (ZFYVE27 Produkte)

Synonyme: ZFYVE27 antikoerper, MGC130947 antikoerper, spg33 antikoerper, im:7137347 antikoerper, zgc:153156 antikoerper, PROTRUDIN antikoerper, RP11-459F3.2 antikoerper, SPG33 antikoerper, 2210011N02Rik antikoerper, 9530077C24Rik antikoerper, AI426636 antikoerper, AI593546 antikoerper, AI835681 antikoerper, zinc finger FYVE-type containing 27 antikoerper, zinc finger FYVE domain containing 27 L homeolog antikoerper, zinc finger FYVE domain containing 27 antikoerper, zinc finger, FYVE domain containing 27 antikoerper, ZFYVE27 antikoerper, zfyve27.L antikoerper, zfyve27 antikoerper, Zfyve27 antikoerper

Hintergrund: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung