SLC12A2 Antikörper

Produktnummer ABIN630304

Produktdetails anti-SLC12A2 Antikörper

Target: SLC12A2 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC12A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SLC12 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC12A2 Blocking Peptide, catalog no. 33R-3991, is also available for use as a blocking control in assays to test for specificity of this SLC12A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC12A2

Target: SLC12A2 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2))

Andere Bezeichnung: SLC12A2 (SLC12A2 Produkte)

Synonyme: BSC antikoerper, BSC2 antikoerper, NKCC1 antikoerper, Bsc2 antikoerper, Nkcc1 antikoerper, bsc2 antikoerper, 9330166H04Rik antikoerper, mBSC2 antikoerper, sy-ns antikoerper, solute carrier family 12 member 2 antikoerper, solute carrier family 12, member 2 antikoerper, SLC12A2 antikoerper, Slc12a2 antikoerper

Hintergrund: By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.

Molekulargewicht: 131 kDa (MW of target protein)

Pathways: Sensory Perception of Sound