SC4MOL Antikörper (N-Term)
-
- Target Alle SC4MOL (MSMO1) Antikörper anzeigen
- SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SC4MOL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SC4 MOL antibody was raised against the N terminal of SC4 OL
- Aufreinigung
- Purified
- Immunogen
- SC4 MOL antibody was raised using the N terminal of SC4 OL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
- Top Product
- Discover our top product MSMO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SC4MOL Blocking Peptide, catalog no. 33R-5780, is also available for use as a blocking control in assays to test for specificity of this SC4MOL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 OL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))
- Andere Bezeichnung
- SC4MOL (MSMO1 Produkte)
- Hintergrund
- Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.
- Molekulargewicht
- 35 kDa (MW of target protein)
-