MGC39633 (N-Term) Antikörper
-
- Target
- MGC39633
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- MGC39633 antibody was raised against the N terminal Of Mgc39633
- Aufreinigung
- Purified
- Immunogen
- MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE
-
anti-MGC39633 (N-Term) antibody
Reaktivität: Human, Kaninchen, Ratte, Rind (Kuh), Pferd, Maus, Schwein IHC, WB Wirt: Kaninchen Polyclonal unconjugated
anti-MGC39633 antibodyReaktivität: Human, Hund IHC, WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MGC39633 Blocking Peptide, catalog no. 33R-9790, is also available for use as a blocking control in assays to test for specificity of this MGC39633 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC39633 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGC39633
- Hintergrund
- The function of MGC39633 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 62 kDa (MW of target protein)
-
