SLC25A29 Antikörper (C-Term)

Produktnummer ABIN630313

Produktdetails anti-SLC25A29 Antikörper

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC25 A29 antibody was raised against the C terminal of SLC25 29

Aufreinigung: Purified

Immunogen: SLC25 A29 antibody was raised using the C terminal of SLC25 29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A29 Blocking Peptide, catalog no. 33R-1129, is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A29

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Andere Bezeichnung: SLC25A29 (SLC25A29 Produkte)

Synonyme: zgc:114094 antikoerper, SLC25A29 antikoerper, slc25a29 antikoerper, MGC122743 antikoerper, C14orf69 antikoerper, CACL antikoerper, ORNT3 antikoerper, C030003J19Rik antikoerper, mCACL antikoerper, solute carrier family 25 member 29 antikoerper, solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 L homeolog antikoerper, solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 antikoerper, solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29 antikoerper, SLC25A29 antikoerper, slc25a29.L antikoerper, slc25a29 antikoerper, Slc25a29 antikoerper

Hintergrund: SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.

Molekulargewicht: 33 kDa (MW of target protein)