SLC25A29 Antikörper (C-Term)
-
- Target Alle SLC25A29 Antikörper anzeigen
- SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))
- Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A29 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC25 A29 antibody was raised against the C terminal of SLC25 29
- Aufreinigung
- Purified
- Immunogen
- SLC25 A29 antibody was raised using the C terminal of SLC25 29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA
- Top Product
- Discover our top product SLC25A29 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A29 Blocking Peptide, catalog no. 33R-1129, is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 29 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))
- Andere Bezeichnung
- SLC25A29 (SLC25A29 Produkte)
- Hintergrund
- SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.
- Molekulargewicht
- 33 kDa (MW of target protein)
-