COX IV Antikörper (N-Term)

Produktnummer ABIN630318

Produktdetails anti-COX IV Antikörper

Target: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COX IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: COX4 I1 antibody was raised against the N terminal of COX4 1

Aufreinigung: Purified

Immunogen: COX4 I1 antibody was raised using the N terminal of COX4 1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COX4I1 Blocking Peptide, catalog no. 33R-1282, is also available for use as a blocking control in assays to test for specificity of this COX4I1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COX IV

Target: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Andere Bezeichnung: COX4I1 (COX4I1 Produkte)

Synonyme: COX4 antikoerper, COX4-1 antikoerper, COXIV antikoerper, mg:bb02d03 antikoerper, zgc:110058 antikoerper, GB20012 antikoerper, AL024441 antikoerper, Cox4 antikoerper, Cox4a antikoerper, cox4 antikoerper, cox4i1 antikoerper, coxiv antikoerper, BcDNA:AT07685 antikoerper, CG10396 antikoerper, COX IV antikoerper, CX41 antikoerper, CX42 antikoerper, Dmel\CG10396 antikoerper, IV antikoerper, cytochrome c oxidase subunit 4I1 antikoerper, cytochrome c oxidase subunit IV isoform 1 antikoerper, cytochrome c oxidase subunit 4 isoform 1, mitochondrial antikoerper, cytochrome c oxidase polypeptide IV antikoerper, cytochrome c oxidase subunit IV antikoerper, cytochrome c oxidase subunit 4i1 antikoerper, cytochrome c oxidase subunit IV isoform 1 S homeolog antikoerper, Cytochrome c oxidase subunit 4-like antikoerper, COX4I1 antikoerper, cox4i1 antikoerper, LOC412396 antikoerper, Cox4I1 antikoerper, LOC780848 antikoerper, BMEII0322 antikoerper, RSal33209_1582 antikoerper, SJAG_00976 antikoerper, HMPREF0733_11926 antikoerper, Cox4i1 antikoerper, cox4i1.S antikoerper, COX4L antikoerper

Hintergrund: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Proton Transport