COX15 Antikörper
-
- Target Alle COX15 Antikörper anzeigen
- COX15 (Cytochrome C Oxidase Assembly Homolog 15 (COX15))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COX15 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
- Top Product
- Discover our top product COX15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COX15 Blocking Peptide, catalog no. 33R-2231, is also available for use as a blocking control in assays to test for specificity of this COX15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX15 (Cytochrome C Oxidase Assembly Homolog 15 (COX15))
- Andere Bezeichnung
- COX15 (COX15 Produkte)
- Synonyme
- COX15 antikoerper, wu:fa18g06 antikoerper, zgc:56240 antikoerper, zgc:77422 antikoerper, 2900026G05Rik antikoerper, CEMCOX2 antikoerper, COX15, cytochrome c oxidase assembly homolog antikoerper, COX15 homolog, cytochrome c oxidase assembly protein (yeast) antikoerper, COX15 cytochrome c oxidase assembly homolog antikoerper, cytochrome c oxidase assembly homolog 15 (yeast) antikoerper, cytochrome c oxidase assembly protein 15 antikoerper, cytochrome c oxidase assembly protein COX15 homolog antikoerper, COX15 antikoerper, Cox15 antikoerper, cox15 antikoerper, LOC100410987 antikoerper, LOC100599631 antikoerper
- Hintergrund
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.
- Molekulargewicht
- 44 kDa (MW of target protein)
-