SLC25A14 Antikörper
-
- Target Alle SLC25A14 Antikörper anzeigen
- SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC25 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV
- Top Product
- Discover our top product SLC25A14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A14 Blocking Peptide, catalog no. 33R-8540, is also available for use as a blocking control in assays to test for specificity of this SLC25A14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))
- Andere Bezeichnung
- SLC25A14 (SLC25A14 Produkte)
- Synonyme
- ATPUMP5 antikoerper, DIC1 antikoerper, DICARBOXYLATE CARRIER 1 antikoerper, F14M13.10 antikoerper, F14M13_10 antikoerper, PLANT UNCOUPLING MITOCHONDRIAL PROTEIN 5 antikoerper, uncoupling protein 5 antikoerper, zgc:55596 antikoerper, BMCP1 antikoerper, UCP5 antikoerper, BMCP-1 antikoerper, Ucp5 antikoerper, UCP5L antikoerper, UCP5S antikoerper, Bmcp1 antikoerper, solute carrier family 25 member 14 antikoerper, uncoupling protein 5 antikoerper, solute carrier family 25 (mitochondrial carrier, brain), member 14 antikoerper, SLC25A14 antikoerper, UCP5 antikoerper, slc25a14 antikoerper, Slc25a14 antikoerper
- Hintergrund
- Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Proton Transport
-