LETM1 Antikörper (Middle Region)
-
- Target Alle LETM1 Antikörper anzeigen
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LETM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LETM1 antibody was raised against the middle region of LETM1
- Aufreinigung
- Purified
- Immunogen
- LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
- Top Product
- Discover our top product LETM1 Primärantikörper
-
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 601-708) antibody
LETM1 Reaktivität: Human WB, ELISA, IF, IP, IHC (p) Wirt: Maus Monoclonal 6F7 unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (C-Term) antibodyLETM1 Reaktivität: Human, Maus WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 1-739) antibodyLETM1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 443-543) antibodyLETM1 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 1-739) antibodyLETM1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (Internal Region) antibodyLETM1 Reaktivität: Human, Maus, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 601-708) antibodyLETM1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 577-607), (C-Term) antibodyLETM1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37176 unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 1-140) antibodyLETM1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 271-320) antibodyLETM1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Schwein, Fledermaus, Huhn, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LETM1 Blocking Peptide, catalog no. 33R-5689, is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
- Andere Bezeichnung
- LETM1 (LETM1 Produkte)
- Synonyme
- LETM1 antikoerper, wu:fc31h08 antikoerper, wu:fc58h01 antikoerper, zgc:109969 antikoerper, letm1 antikoerper, MGC145623 antikoerper, leucine zipper and EF-hand containing transmembrane protein 1 antikoerper, leucine zipper-EF-hand containing transmembrane protein 1 antikoerper, LETM1 and EF-hand domain-containing protein 1, mitochondrial antikoerper, LETM1 antikoerper, letm1 antikoerper, LOC100346816 antikoerper, Letm1 antikoerper
- Hintergrund
- The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.
- Molekulargewicht
- 60 kDa (MW of target protein)
-
