LETM1 Antikörper (Middle Region)
-
- Target Alle LETM1 Antikörper anzeigen
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LETM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LETM1 antibody was raised against the middle region of LETM1
- Aufreinigung
- Purified
- Immunogen
- LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
- Top Product
- Discover our top product LETM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LETM1 Blocking Peptide, catalog no. 33R-5689, is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
- Andere Bezeichnung
- LETM1 (LETM1 Produkte)
- Hintergrund
- The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.
- Molekulargewicht
- 60 kDa (MW of target protein)
-