Fukutin Antikörper (N-Term)
-
- Target Alle Fukutin (FKTN) Antikörper anzeigen
- Fukutin (FKTN)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fukutin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- FKTN antibody was raised against the N terminal Of Fktn
- Aufreinigung
- Purified
- Immunogen
- FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL
- Top Product
- Discover our top product FKTN Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FKTN Blocking Peptide, catalog no. 33R-8971, is also available for use as a blocking control in assays to test for specificity of this FKTN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKTN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fukutin (FKTN)
- Andere Bezeichnung
- FKTN (FKTN Produkte)
- Hintergrund
- FKTN regulates the migration and assembly of neurons during cortical histogenesis. Fukuyama congenital muscular dystrophy results from mutations in its gene.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Regulation of Carbohydrate Metabolic Process
-