Reticulon 2 Antikörper (N-Term)

Produktnummer ABIN630331

Produktdetails anti-Reticulon 2 Antikörper

Target: Reticulon 2 (RTN2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Reticulon 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RTN2 antibody was raised against the N terminal of RTN2

Aufreinigung: Purified

Immunogen: RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RTN2 Blocking Peptide, catalog no. 33R-6064, is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Reticulon 2

Target: Reticulon 2 (RTN2)

Andere Bezeichnung: RTN2 (RTN2 Produkte)

Synonyme: rtn2 antikoerper, RTN2 antikoerper, nsp2 antikoerper, nspl1 antikoerper, xrtn2 antikoerper, RTN2-A antikoerper, TTpA048i08 antikoerper, NSP2 antikoerper, NSPL1 antikoerper, NSPLI antikoerper, SPG12 antikoerper, RTN2-B antikoerper, RTN2-C antikoerper, MMS10-P antikoerper, Ms10p antikoerper, Nspl1 antikoerper, reticulon 2 antikoerper, reticulon-2 antikoerper, reticulon 2 L homeolog antikoerper, reticulon 2 (Z-band associated protein) antikoerper, rtn2 antikoerper, RTN2 antikoerper, LOC484444 antikoerper, Rtn2 antikoerper, rtn2.L antikoerper

Hintergrund: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Molekulargewicht: 51 kDa (MW of target protein)