Corin Antikörper (C-Term)

Produktnummer ABIN630332

Produktdetails anti-Corin Antikörper

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Corin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CORIN antibody was raised against the C terminal of CORIN

Aufreinigung: Purified

Immunogen: CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CORIN Blocking Peptide, catalog no. 33R-3817, is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CORIN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Corin

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Andere Bezeichnung: CORIN (CORIN Produkte)

Synonyme: CORIN antikoerper, CG2105 antikoerper, Dmel\\CG2105 antikoerper, SP75 antikoerper, LOC559109 antikoerper, AV273130 antikoerper, Lrp4 antikoerper, ATC2 antikoerper, CRN antikoerper, PEE5 antikoerper, TMPRSS10 antikoerper, corin, serine peptidase antikoerper, CG2105 gene product from transcript CG2105-RC antikoerper, novel protein similar to H.sapiens CORIN, corin, serine peptidase (CORIN) antikoerper, corin antikoerper, CORIN antikoerper, Corin antikoerper, LOC559109 antikoerper

Hintergrund: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Molekulargewicht: 74 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones