Pannexin 2 Antikörper (N-Term)
-
- Target Alle Pannexin 2 (PANX2) Antikörper anzeigen
- Pannexin 2 (PANX2)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Säugetier
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Pannexin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Pannexin 2 antibody was raised against the N terminal of PANX2
- Kreuzreaktivität
- Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)
- Aufreinigung
- Purified
- Immunogen
- Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
- Top Product
- Discover our top product PANX2 Primärantikörper
-
anti-Pannexin 2 (PANX2) (AA 370-470) antibody
PANX2 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Pannexin 2 (PANX2) (AA 133-219) antibodyPANX2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2B11 unconjugated
anti-Pannexin 2 (PANX2) (N-Term) antibodyPANX2 Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Pferd, Rind (Kuh), Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Pannexin 2 (PANX2) (AA 57-106) antibodyPANX2 Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Pferd, Rind (Kuh), Meerschweinchen, Affe, Fledermaus, Huhn, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Pannexin 2 (PANX2) (AA 647-677), (C-Term) antibodyPANX2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB39842 unconjugated
anti-Pannexin 2 (PANX2) (1st Extracellular Loop), (AA 76-90) antibodyPANX2 Reaktivität: Human, Maus, Ratte WB, IF, ICC, LCI Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Pannexin 2 Blocking Peptide, catalog no. 33R-3625, is also available for use as a blocking control in assays to test for specificity of this Pannexin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pannexin 2 (PANX2)
- Andere Bezeichnung
- Pannexin 2 (PANX2 Produkte)
- Synonyme
- PANX2 antikoerper, si:ch211-192n14.2 antikoerper, PX2 antikoerper, hPANX2 antikoerper, pannexin 2 antikoerper, PANX2 antikoerper, LOC100533356 antikoerper, panx2 antikoerper, Panx2 antikoerper
- Hintergrund
- PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.
- Molekulargewicht
- 70 kDa (MW of target protein)
-
