SEC63 Antikörper
-
- Target Alle SEC63 Antikörper anzeigen
- SEC63 (SEC63 Homolog (SEC63))
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEC63 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
- Top Product
- Discover our top product SEC63 Primärantikörper
-
anti-SEC63 Homolog (SEC63) (AA 631-728) antibody
SEC63 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1A8 unconjugated
anti-SEC63 Homolog (SEC63) (C-Term) antibodySEC63 Reaktivität: Human, Maus, Ratte WB, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 1-760) antibodySEC63 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 139-168), (N-Term) antibodySEC63 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB32397 unconjugated
anti-SEC63 Homolog (SEC63) (AA 651-700) antibodySEC63 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Hund, Meerschweinchen, Rind (Kuh), Pferd, Fledermaus, Affe, Huhn, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 35-84) antibodySEC63 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Hund, Meerschweinchen, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 139-168) antibodySEC63 Reaktivität: Human WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (N-Term) antibodySEC63 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Meerschweinchen, Rind (Kuh), Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEC63 Blocking Peptide, catalog no. 33R-10039, is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEC63 (SEC63 Homolog (SEC63))
- Andere Bezeichnung
- SEC63 (SEC63 Produkte)
- Synonyme
- DNAJC23 antikoerper, ERdj2 antikoerper, PRO2507 antikoerper, SEC63L antikoerper, 5730478J10Rik antikoerper, AI649014 antikoerper, AW319215 antikoerper, SEC63-like antikoerper, zgc:92718 antikoerper, SEC63 homolog, protein translocation regulator antikoerper, SEC63-like (S. cerevisiae) antikoerper, SEC63 homolog, protein translocation regulator L homeolog antikoerper, SEC63 antikoerper, Sec63 antikoerper, sec63 antikoerper, sec63.L antikoerper
- Hintergrund
- The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.
- Molekulargewicht
- 88 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-
