SRPRB Antikörper (C-Term)
-
- Target Alle SRPRB Antikörper anzeigen
- SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRPRB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SRPRB antibody was raised against the C terminal of SRPRB
- Aufreinigung
- Purified
- Immunogen
- SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI
- Top Product
- Discover our top product SRPRB Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SRPRB Blocking Peptide, catalog no. 33R-1415, is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPRB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))
- Andere Bezeichnung
- SRPRB (SRPRB Produkte)
- Hintergrund
- SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-