SRPRB Antikörper (C-Term)

Produktnummer ABIN630341

Produktdetails anti-SRPRB Antikörper

Target: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRPRB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SRPRB antibody was raised against the C terminal of SRPRB

Aufreinigung: Purified

Immunogen: SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRPRB Blocking Peptide, catalog no. 33R-1415, is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPRB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRPRB

Target: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Andere Bezeichnung: SRPRB (SRPRB Produkte)

Synonyme: wu:fk57h10 antikoerper, zgc:111820 antikoerper, zgc:92746 antikoerper, apmcf1 antikoerper, APMCF1 antikoerper, AA409543 antikoerper, Ab2-417 antikoerper, Ba1-667 antikoerper, Cc1-8 antikoerper, signal recognition particle receptor, B subunit antikoerper, SRP receptor beta subunit S homeolog antikoerper, SRP receptor beta subunit antikoerper, SRPRB antikoerper, srprb antikoerper, srprb.S antikoerper, Srprb antikoerper

Hintergrund: SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling