SLC1A5 Antikörper

Produktnummer ABIN630342

Produktdetails anti-SLC1A5 Antikörper

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC1A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC1A5 Blocking Peptide, catalog no. 33R-2915, is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-SLC1A5 Antikörper (ABIN630342)

Krämer, Gröner, Hoffmann, Craig, Brugger, Drzezga, Timmer, Neumaier, Zlatopolskiy, Endepols, Neumaier: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." in: Cancers, Vol. 13, Issue 23, (2021) (PubMed).

Details zu SLC1A5

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Andere Bezeichnung: SLC1A5 (SLC1A5 Produkte)

Synonyme: aaat antikoerper, asct2 antikoerper, atbo antikoerper, m7v1 antikoerper, m7vs1 antikoerper, r16 antikoerper, rdrc antikoerper, AAAT antikoerper, ASCT2 antikoerper, ATBO antikoerper, M7V1 antikoerper, M7VS1 antikoerper, R16 antikoerper, RDRC antikoerper, Slc1a7 antikoerper, Asct2 antikoerper, H4-ASCT2 antikoerper, solute carrier family 1 (neutral amino acid transporter), member 5 antikoerper, solute carrier family 1 member 5 S homeolog antikoerper, solute carrier family 1 member 5 antikoerper, slc1a5 antikoerper, slc1a5.S antikoerper, SLC1A5 antikoerper, Slc1a5 antikoerper

Hintergrund: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport, Warburg Effekt