SLC1A5 Antikörper
(1 reference)-
- Target Alle SLC1A5 Antikörper anzeigen
- SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC1A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
- Top Product
- Discover our top product SLC1A5 Primärantikörper
-
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Internal Region) antibody
SLC1A5 Reaktivität: Human, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Middle Region) antibodySLC1A5 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Schwein, Schaf, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (AA 1-100) antibodySLC1A5 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (AA 241-290) antibodySLC1A5 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Schwein, Schaf, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) antibodySLC1A5 Reaktivität: Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) antibodySLC1A5 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (AA 186-214) antibodySLC1A5 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB18498 unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) antibodySLC1A5 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 1 Member 5 (SLC1A5) (Internal Region) antibodySLC1A5 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC1A5 Blocking Peptide, catalog no. 33R-2915, is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." in: Cancers, Vol. 13, Issue 23, (2021) (PubMed).
-
: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." in: Cancers, Vol. 13, Issue 23, (2021) (PubMed).
-
- Target
- SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))
- Andere Bezeichnung
- SLC1A5 (SLC1A5 Produkte)
- Hintergrund
- SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.
- Molekulargewicht
- 60 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport, Warburg Effekt
-
