AGPAT2 Antikörper (C-Term)

Produktnummer ABIN630343

Produktdetails anti-AGPAT2 Antikörper

Target: AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGPAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AGPAT2 antibody was raised against the C terminal of AGPAT2

Aufreinigung: Purified

Immunogen: AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGPAT2 Blocking Peptide, catalog no. 33R-4874, is also available for use as a blocking control in assays to test for specificity of this AGPAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGPAT2

Target: AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))

Andere Bezeichnung: AGPAT2 (AGPAT2 Produkte)

Synonyme: AGPAT2 antikoerper, zgc:153984 antikoerper, 1-agpat2 antikoerper, bscl antikoerper, bscl1 antikoerper, lpaab antikoerper, lpaat-beta antikoerper, 1-AGPAT2 antikoerper, BSCL antikoerper, BSCL1 antikoerper, LPAAB antikoerper, LPAAT-beta antikoerper, 2510002J07Rik antikoerper, AV000834 antikoerper, 1-acylglycerol-3-phosphate O-acyltransferase 2 antikoerper, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) antikoerper, AGPAT2 antikoerper, agpat2 antikoerper, Agpat2 antikoerper

Hintergrund: AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.

Molekulargewicht: 27 kDa (MW of target protein)