USP48 Antikörper (Middle Region)

Produktnummer ABIN630347

Produktdetails anti-USP48 Antikörper

Target: USP48 (Ubiquitin Specific Peptidase 48 (USP48))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser USP48 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: USP48 antibody was raised against the middle region of USP48

Aufreinigung: Purified

Immunogen: USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

USP48 Blocking Peptide, catalog no. 33R-1333, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP48 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu USP48

Target: USP48 (Ubiquitin Specific Peptidase 48 (USP48))

Andere Bezeichnung: USP48 (USP48 Produkte)

Synonyme: RAP1GA1 antikoerper, USP31 antikoerper, 2810449C13Rik antikoerper, AI115503 antikoerper, BC021769 antikoerper, D330022K21Rik antikoerper, Usp31 antikoerper, synUSP antikoerper, USP48 antikoerper, MGC135142 antikoerper, zgc:112364 antikoerper, ubiquitin specific peptidase 48 antikoerper, ubiquitin specific peptidase 31 antikoerper, USP48 antikoerper, Usp48 antikoerper, usp48 antikoerper, USP31 antikoerper

Hintergrund: USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

Molekulargewicht: 70 kDa (MW of target protein)