CHIC1 Antikörper (N-Term)

Produktnummer ABIN630348

Produktdetails anti-CHIC1 Antikörper

Target: CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHIC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHIC1 antibody was raised against the N terminal of CHIC1

Aufreinigung: Purified

Immunogen: CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHIC1 Blocking Peptide, catalog no. 33R-5387, is also available for use as a blocking control in assays to test for specificity of this CHIC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHIC1

Target: CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))

Andere Bezeichnung: CHIC1 (CHIC1 Produkte)

Synonyme: wu:fj33g02 antikoerper, BRX antikoerper, Brx antikoerper, cysteine-rich hydrophobic domain 1 antikoerper, cysteine rich hydrophobic domain 1 antikoerper, chic1 antikoerper, CHIC1 antikoerper, Chic1 antikoerper

Hintergrund: The function of CHIC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 24 kDa (MW of target protein)