UBE2J2 Antikörper

Produktnummer ABIN630350

Produktdetails anti-UBE2J2 Antikörper

Target: UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2J2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: UBE2 J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2J2 Blocking Peptide, catalog no. 33R-3342, is also available for use as a blocking control in assays to test for specificity of this UBE2J2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2J2

Target: UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))

Andere Bezeichnung: UBE2J2 (UBE2J2 Produkte)

Synonyme: NCUBE-2 antikoerper, NCUBE2 antikoerper, PRO2121 antikoerper, 1200007B18Rik antikoerper, 2400008G19Rik antikoerper, 5730472G04Rik antikoerper, AL022923 antikoerper, Ubc6 antikoerper, Ubc6p antikoerper, zgc:162164 antikoerper, ubiquitin conjugating enzyme E2 J2 antikoerper, ubiquitin-conjugating enzyme E2J 2 antikoerper, ubiquitin-conjugating enzyme E2, J2 antikoerper, ubiquitin-conjugating enzyme E2 J2 antikoerper, ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) antikoerper, ubiquitin conjugating enzyme E2 J2 L homeolog antikoerper, UBE2J2 antikoerper, Ube2j2 antikoerper, LOC5574000 antikoerper, CpipJ_CPIJ008956 antikoerper, ube2j2 antikoerper, uce2 antikoerper, ube2j2.L antikoerper, LOC100067387 antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.

Molekulargewicht: 30 kDa (MW of target protein)