SLC26A5 Antikörper

Produktnummer ABIN630355

Produktdetails anti-SLC26A5 Antikörper

Target: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC26A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC26 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A5 Blocking Peptide, catalog no. 33R-3083, is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC26A5

Target: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Andere Bezeichnung: SLC26A5 (SLC26A5 Produkte)

Synonyme: pres antikoerper, fb73d12 antikoerper, fb74g12 antikoerper, wu:fb73d12 antikoerper, wu:fb74g12 antikoerper, DFNB61 antikoerper, PRES antikoerper, Pres antikoerper, prestin antikoerper, solute carrier family 26 (anion exchanger), member 5 antikoerper, solute carrier family 26 member 5 antikoerper, solute carrier family 26, member 5 antikoerper, slc26a5 antikoerper, SLC26A5 antikoerper, Slc26a5 antikoerper

Hintergrund: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.

Molekulargewicht: 81 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Dicarboxylic Acid Transport