ABCD4 Antikörper

Produktnummer ABIN630357

Produktdetails anti-ABCD4 Antikörper

Target: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCD4 Blocking Peptide, catalog no. 33R-2911, is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCD4

Target: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Andere Bezeichnung: ABCD4 (ABCD4 Produkte)

Synonyme: ABC41 antikoerper, EST352188 antikoerper, MAHCJ antikoerper, P70R antikoerper, P79R antikoerper, PMP69 antikoerper, PXMP1L antikoerper, Pxmp1l antikoerper, ABCD4 antikoerper, zgc:153503 antikoerper, P69r antikoerper, ATP binding cassette subfamily D member 4 antikoerper, ATP-binding cassette, sub-family D (ALD), member 4 antikoerper, ABCD4 antikoerper, Abcd4 antikoerper, abcd4 antikoerper

Hintergrund: ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis.

Molekulargewicht: 55 kDa (MW of target protein)