PTRH2 Antikörper (C-Term)

Produktnummer ABIN630358

Produktdetails anti-PTRH2 Antikörper

Target: PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTRH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTRH2 antibody was raised against the C terminal of PTRH2

Aufreinigung: Purified

Immunogen: PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTRH2 Blocking Peptide, catalog no. 33R-8080, is also available for use as a blocking control in assays to test for specificity of this PTRH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTRH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTRH2

Target: PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))

Andere Bezeichnung: PTRH2 (PTRH2 Produkte)

Synonyme: BIT1 antikoerper, PTH2 antikoerper, A230072I16Rik antikoerper, Bit1 antikoerper, CGI-147 antikoerper, wu:fj09f02 antikoerper, zgc:109954 antikoerper, RGD1306819 antikoerper, peptidyl-tRNA hydrolase 2 antikoerper, ptrh2 antikoerper, CC1G_10259 antikoerper, ANI_1_1036184 antikoerper, AOR_1_2082154 antikoerper, PTRH2 antikoerper, Ptrh2 antikoerper

Hintergrund: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

Molekulargewicht: 20 kDa (MW of target protein)