CLCC1 Antikörper (N-Term)

Produktnummer ABIN630362

Produktdetails anti-CLCC1 Antikörper

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CLCC1 antibody was raised against the N terminal of CLCC1

Aufreinigung: Purified

Immunogen: CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLCC1 Blocking Peptide, catalog no. 33R-6106, is also available for use as a blocking control in assays to test for specificity of this CLCC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLCC1

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Andere Bezeichnung: CLCC1 (CLCC1 Produkte)

Synonyme: CLCC1 antikoerper, clcc1 antikoerper, MCLC antikoerper, Mclc antikoerper, chloride channel CLIC like 1 antikoerper, Chloride channel CLIC-like protein 1 antikoerper, chloride channel CLIC-like 1 antikoerper, chloride channel CLIC-like 1 S homeolog antikoerper, CLCC1 antikoerper, clcc1 antikoerper, Clcc1 antikoerper, clcc1.S antikoerper

Hintergrund: CLCC1 seems to act as a chloride ion channel.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion