SLC6A18 Antikörper (Middle Region)

Produktnummer ABIN630375

Produktdetails anti-SLC6A18 Antikörper

Target: SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC6A18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLC6 A18 antibody was raised against the middle region of SLC6 18

Aufreinigung: Purified

Immunogen: SLC6 A18 antibody was raised using the middle region of SLC6 18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A18 Blocking Peptide, catalog no. 33R-6097, is also available for use as a blocking control in assays to test for specificity of this SLC6A18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC6A18

Target: SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))

Andere Bezeichnung: SLC6A18 (SLC6A18 Produkte)

Synonyme: SLC6A18 antikoerper, zgc:172267 antikoerper, B0AT3 antikoerper, D630001K16Rik antikoerper, Xt2 antikoerper, Xtrp2 antikoerper, Rosit antikoerper, solute carrier family 6 member 18 antikoerper, solute carrier family 6 (neutral amino acid transporter), member 18 antikoerper, solute carrier family 6 (neurotransmitter transporter), member 18 antikoerper, solute carrier family 6, member 18 antikoerper, SLC6A18 antikoerper, slc6a18 antikoerper, Slc6a18 antikoerper

Hintergrund: The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions.

Molekulargewicht: 69 kDa (MW of target protein)