SLC19A1 Antikörper
-
- Target Alle SLC19A1 Antikörper anzeigen
- SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC19A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
- Top Product
- Discover our top product SLC19A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC19A1 Blocking Peptide, catalog no. 33R-6599, is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))
- Andere Bezeichnung
- SLC19A1 (SLC19A1 Produkte)
- Synonyme
- A1 antikoerper, MHCBFB antikoerper, PO-GA antikoerper, RECC1 antikoerper, RFC antikoerper, RFC140 antikoerper, CHMD antikoerper, FOLT antikoerper, IFC1 antikoerper, REFC antikoerper, RFC1 antikoerper, LOC100226745 antikoerper, AI323572 antikoerper, RFC-1 antikoerper, MTX1 antikoerper, XRFC antikoerper, chmd antikoerper, folt antikoerper, ifc1 antikoerper, refc antikoerper, rfc1 antikoerper, slc19a1 antikoerper, replication factor C subunit 1 antikoerper, solute carrier family 19 member 1 antikoerper, folate transporter 1 antikoerper, solute carrier family 19 (folate transporter), member 1 antikoerper, solute carrier family 19 (folate transporter), member 1 L homeolog antikoerper, RFC1 antikoerper, SLC19A1 antikoerper, LOC100226745 antikoerper, Slc19a1 antikoerper, slc19a1.L antikoerper
- Hintergrund
- Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-