CRELD1 Antikörper (C-Term)
-
- Target Alle CRELD1 Antikörper anzeigen
- CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRELD1 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- CRELD1 antibody was raised against the C terminal of CRELD1
- Aufreinigung
- Purified
- Immunogen
- CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
- Top Product
- Discover our top product CRELD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRELD1 Blocking Peptide, catalog no. 33R-9056, is also available for use as a blocking control in assays to test for specificity of this CRELD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRELD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))
- Andere Bezeichnung
- CRELD1 (CRELD1 Produkte)
- Hintergrund
- Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.
- Molekulargewicht
- 45 kDa (MW of target protein)
-