WSCD2 Antikörper (C-Term)

Produktnummer ABIN630386

Produktdetails anti-WSCD2 Antikörper

Target: WSCD2 (WSC Domain Containing 2 (WSCD2))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WSCD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WSCD2 antibody was raised against the C terminal of WSCD2

Aufreinigung: Purified

Immunogen: WSCD2 antibody was raised using the C terminal of WSCD2 corresponding to a region with amino acids GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WSCD2 Blocking Peptide, catalog no. 33R-3446, is also available for use as a blocking control in assays to test for specificity of this WSCD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WSCD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WSCD2

Target: WSCD2 (WSC Domain Containing 2 (WSCD2))

Andere Bezeichnung: WSCD2 (WSCD2 Produkte)

Synonyme: si:ch211-240b21.1 antikoerper, 4933413A10Rik antikoerper, C530024P05Rik antikoerper, Gm450 antikoerper, WSC domain containing 2 antikoerper, WSC domain-containing protein 2 antikoerper, WSCD2 antikoerper, MGYG_08833 antikoerper, MGYG_08830 antikoerper, wscd2 antikoerper, Wscd2 antikoerper

Hintergrund: The WSCD2 protein possesses acetylglucosaminyltransferase activity.

Molekulargewicht: 64 kDa (MW of target protein)