LAPTM4A Antikörper (Middle Region)

Produktnummer ABIN630387

Produktdetails anti-LAPTM4A Antikörper

Target: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAPTM4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LAPTM4 A antibody was raised against the middle region of LAPTM4

Aufreinigung: Purified

Immunogen: LAPTM4 A antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAPTM4A Blocking Peptide, catalog no. 33R-9682, is also available for use as a blocking control in assays to test for specificity of this LAPTM4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAPTM4A

Target: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Andere Bezeichnung: LAPTM4A (LAPTM4A Produkte)

Synonyme: HUMORF13 antikoerper, LAPTM4 antikoerper, MBNT antikoerper, Mtrp antikoerper, wu:fb57c07 antikoerper, wu:fj99e08 antikoerper, laptm4 antikoerper, laptm4a antikoerper, laptm4aa antikoerper, mbnt antikoerper, mtrp antikoerper, AA286466 antikoerper, MTP antikoerper, mKIAA0108 antikoerper, lysosomal protein transmembrane 4 alpha antikoerper, lysosomal-associated protein transmembrane 4 alpha L homeolog antikoerper, lysosomal-associated protein transmembrane 4A antikoerper, LAPTM4A antikoerper, Laptm4a antikoerper, laptm4a antikoerper, laptm4a.L antikoerper

Hintergrund: LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined, however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Molekulargewicht: 27 kDa (MW of target protein)